DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and TBP2

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001321103.1 Gene:TBP2 / 841999 AraportID:AT1G55520 Length:200 Species:Arabidopsis thaliana


Alignment Length:228 Identity:43/228 - (18%)
Similarity:94/228 - (41%) Gaps:34/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LANKASEGAEEMSLP-----IVNPREPTLKDVLSIYENVSKLGDIQRYLNVIYKPFYCLAMTTSK 111
            :|::.:||::.:.|.     ||    |||::::|.             :|:           ..|
plant     1 MADQGTEGSQPVDLTKHPSGIV----PTLQNIVST-------------VNL-----------DCK 37

  Fly   112 FHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIRIYPHGNIYCQ-AFCKNSARYGLANILKELR 175
            ..|..:.:..:|..:.|::..|:.:....|..:..|:..|.:.|. |..::.::.......:.::
plant    38 LDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAARKYARIVQ 102

  Fly   176 YLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLENPVVTRYDTSKYPFLVYKMMGTTVEIAIFPT 240
            .||:..:.:..|...:..:..|.|.:.|......:...:.|:...:|.|:|:|....:.:.||.:
plant   103 KLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKLPKIVLLIFVS 167

  Fly   241 GYVIVLFATTMEITKLAIAHILPTLYRLKDPYQ 273
            |.:::..|...|.|..|..:|.|.|...:...|
plant   168 GKIVITGAKMREETYTAFENIYPVLREFRKVQQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 30/155 (19%)
TBP 191..267 CDD:278767 18/75 (24%)
TBP2NP_001321103.1 PLN00062 22..200 CDD:177693 37/205 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.