DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and Tbp

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster


Alignment Length:233 Identity:46/233 - (19%)
Similarity:92/233 - (39%) Gaps:26/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SDRQVLANKASEGAEEM---------SLPIVNPREPTLKDVLSIYENVSKLGDIQRYLNVIYKPF 102
            |:|.|..:.|..|.:.:         |.| :.|..|...|.          |.:.:..|::....
  Fly   134 SERSVGGSGAGGGGDALSNIHQTMGPSTP-MTPATPGSADP----------GIVPQLQNIVSTVN 187

  Fly   103 YCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIRIYPHGNIYCQ-AFCKNSARYG 166
            .|     .|..|.::.:..:|..:.|::..|:.:....|..:..|:..|.:.|. |..::.:|..
  Fly   188 LC-----CKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLA 247

  Fly   167 LANILKELRYLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLENPVVTRYDTSKYPFLVYKMMGT 231
            .....:.::.||:..:....|...:..:..|.|.:.|....|.:...:.|:...:|.|:|:|:..
  Fly   248 ARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRP 312

  Fly   232 TVEIAIFPTGYVIVLFATTMEITKLAIAHILPTLYRLK 269
            .:.:.||.:|.|::..|...:....|...|.|.|.:.|
  Fly   313 RIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 31/155 (20%)
TBP 191..267 CDD:278767 18/75 (24%)
TbpNP_523805.1 PLN00062 176..351 CDD:177693 35/180 (19%)
TBP_eukaryotes 176..349 CDD:239952 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.