DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and Trf2

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster


Alignment Length:314 Identity:73/314 - (23%)
Similarity:124/314 - (39%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSARNNLKRSMPMEA-----LIKTKVMKTASMSRKTLLED---AKLSTSDQDPSDRQVLANKAS 57
            :.|:.|  |.::|..|     ||      ||.|.   |||:   ..::..|.|..:::.:|    
  Fly  1208 LTSSEN--KANLPTVASNGNGLI------TAKMD---LLEEEVMQSITVIDDDDEEKKEVA---- 1257

  Fly    58 EGAEEMSLPIVNPREPTLKDVLSIYENVSKLGDIQRYLNVIYKPFYCLAMTTSKFHLLELDMGLK 122
            |..||.|    |..:|     :.:::.::   |.:..|:::.....|.........|.|:.:...
  Fly  1258 EDEEESS----NNAKP-----IDLHQPIA---DNEHELDIVINNVVCSFSVGCHLKLREIALQGS 1310

  Fly   123 NTAFEPEKHMALFVYRYSPTRSIRIYPHGNIYCQ-AFCKNSARYGLANILKELRYLGYAPRLRRL 186
            |..:..|..|.....|: |..:..|:..|.|.|. |..::.|:.......:.|..||:..|....
  Fly  1311 NVEYRRENGMVTMKLRH-PYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNF 1374

  Fly   187 KTNAVNATFSVPFNLNLRQF---HLENPVVTRYDTSKYPFLVYKMM--GTTVEIAIFPTGYVIVL 246
            :...|..|.|:|:.:.:..|   |.||   ..|:...:|.:.|||.  .....:.||.||.|.|.
  Fly  1375 RIVNVLGTCSMPWAIKIVNFSERHREN---ASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVT 1436

  Fly   247 FATTMEITKLAIAHILPTLYRLKDPYQEQCKLSHSSGDIDYKLLWENHFQKNGD 300
            .|:...: :.||.||.|.::..:.....: :|.|        |..:...|..||
  Fly  1437 AASVNHV-ESAIQHIYPLVFDFRKQRSAE-ELQH--------LRQKQRLQAGGD 1480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 42/160 (26%)
TBP 191..267 CDD:278767 25/80 (31%)
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 44/177 (25%)
PLN00062 1285..1459 CDD:177693 43/178 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.