DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and Tbp

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_038712.3 Gene:Tbp / 21374 MGIID:101838 Length:316 Species:Mus musculus


Alignment Length:250 Identity:52/250 - (20%)
Similarity:94/250 - (37%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LIKTKVMKTASMSRKTLLEDAKLSTSDQDPSDRQVLANKASEGAEEMSLPIVNPREPTLKDVLSI 81
            |..::.:.||.:...|     .|..|...|......|..|||     |..||    |.|::::| 
Mouse    98 LFHSQTLTTAPLPGTT-----PLYPSPMTPMTPITPATPASE-----SSGIV----PQLQNIVS- 147

  Fly    82 YENVSKLGDIQRYLNVIYKPFYCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIR 146
               ...||              |      |..|..:.:..:|..:.|::..|:.:....|..:..
Mouse   148 ---TVNLG--------------C------KLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTAL 189

  Fly   147 IYPHGNIYCQ-AFCKNSARYGLANILKELRYLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLEN 210
            |:..|.:.|. |..:..:|.......:.::.||:..:....|...:..:..|.|.:.|....|.:
Mouse   190 IFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTH 254

  Fly   211 PVVTRYDTSKYPFLVYKMMGTTVEIAIFPTGYVIVLFATTMEITKLAIAHILPTL 265
            ...:.|:...:|.|:|:|:...:.:.||.:|.|::..|........|..:|.|.|
Mouse   255 QQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPIL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 31/155 (20%)
TBP 191..267 CDD:278767 17/74 (23%)
TbpNP_038712.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..135 10/40 (25%)
PLN00062 139..315 CDD:177693 38/198 (19%)
TBP_eukaryotes 139..312 CDD:239952 38/198 (19%)
Repetitive region 142..218 16/99 (16%)
Repetitive region 232..309 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.