DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and tbp-1

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001370645.1 Gene:tbp-1 / 176054 WormBaseID:WBGene00006542 Length:340 Species:Caenorhabditis elegans


Alignment Length:234 Identity:43/234 - (18%)
Similarity:90/234 - (38%) Gaps:41/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DRQVLANKA-----------SEGAEEMSLPIVNPREPTLKDVLSIYENVSKLGDIQRYLNVIYKP 101
            ||..|.::|           :..|.::.:|:     |.|::::|    ...||            
 Worm   135 DRDALTHQAPASNIAATMVPATPASQLDIPM-----PALQNIVS----TVNLG------------ 178

  Fly   102 FYCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIRIYPHGNIYCQ-AFCKNSARY 165
                    .:..|.::.:..:|..:.|::..|:.:....|..:..|:..|.:.|. |..:.::|.
 Worm   179 --------VQLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEASRL 235

  Fly   166 GLANILKELRYLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLENPVVTRYDTSKYPFLVYKMMG 230
            ......:.::.||:..:........:..:..|.|.:.|....:.:...:.|:...:|.|:|:|:.
 Worm   236 AARKYARIVQKLGFQAKFTEFMVQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVK 300

  Fly   231 TTVEIAIFPTGYVIVLFATTMEITKLAIAHILPTLYRLK 269
            ..|.:.||.:|.|::..|.|......|...|.|.|...|
 Worm   301 PRVVLLIFVSGKVVITGAKTKRDIDEAFGQIYPILKGFK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 30/155 (19%)
TBP 191..267 CDD:278767 19/75 (25%)
tbp-1NP_001370645.1 TBP_eukaryotes 165..338 CDD:239952 36/201 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.