DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and tlf-1

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001122474.1 Gene:tlf-1 / 172676 WormBaseID:WBGene00006577 Length:508 Species:Caenorhabditis elegans


Alignment Length:267 Identity:60/267 - (22%)
Similarity:106/267 - (39%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DAKLSTSDQDPSDRQVLANKASEGAEEMSLPIVNP-------REPTLKDVLSIYENVSKLGDIQ- 92
            |..|:...::||...:        ..::.:|.|.|       .||...|           |||. 
 Worm   223 DMNLAVPLREPSPEPI--------PVKIEVPDVPPEGTSAANEEPMPDD-----------GDIDI 268

  Fly    93 RYLNVIYKPFYCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIRIYPHGNIY--- 154
            :..||:..  |.|.:   ...|.:|.|...|..:|.||.: :...:.||...|::|..|.:|   
 Worm   269 QIRNVVCN--YTLPL---HIDLRKLAMNTHNVTYEREKGV-MMKQKRSPGCYIKVYSSGKVYIVG 327

  Fly   155 C--QAFCKNSARYGLANILKEL-RYLGYAPR---LRRLKTNAVNATFSVPFNLNLRQFHLENPVV 213
            |  :|.||.:||    :|.:.: |.:|....   :|..:.|.|.||..:||.:.:.:...:.|..
 Worm   328 CRSEADCKRAAR----SIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFGIKIEEVAAKYPSE 388

  Fly   214 TRYDTSKYPFLVYKMMGTTVEIAIFPTGYVIVLFATTMEITKLAIAHILPTLYRLKDPYQEQCKL 278
            :.|:......||::.:.....:.|..||.:.|..|.:.......::.|.|.:...:      | |
 Worm   389 STYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIVLEFR------C-L 446

  Fly   279 SHSSGDI 285
            ..:.|::
 Worm   447 ERAKGNV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 40/163 (25%)
TBP 191..267 CDD:278767 16/75 (21%)
tlf-1NP_001122474.1 Med15 <3..>218 CDD:312941
KLF1_2_4_N <183..217 CDD:425360
TLF 266..442 CDD:239953 45/185 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.