DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and Tbp

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001004198.1 Gene:Tbp / 117526 RGDID:67398 Length:318 Species:Rattus norvegicus


Alignment Length:250 Identity:52/250 - (20%)
Similarity:94/250 - (37%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LIKTKVMKTASMSRKTLLEDAKLSTSDQDPSDRQVLANKASEGAEEMSLPIVNPREPTLKDVLSI 81
            |..::.:.||.:...|     .|..|...|......|..|||     |..||    |.|::::| 
  Rat   100 LFHSQTLTTAPLPGTT-----PLYPSPMTPMTPITPATPASE-----SSGIV----PQLQNIVS- 149

  Fly    82 YENVSKLGDIQRYLNVIYKPFYCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIR 146
               ...||              |      |..|..:.:..:|..:.|::..|:.:....|..:..
  Rat   150 ---TVNLG--------------C------KLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTAL 191

  Fly   147 IYPHGNIYCQ-AFCKNSARYGLANILKELRYLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLEN 210
            |:..|.:.|. |..:..:|.......:.::.||:..:....|...:..:..|.|.:.|....|.:
  Rat   192 IFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTH 256

  Fly   211 PVVTRYDTSKYPFLVYKMMGTTVEIAIFPTGYVIVLFATTMEITKLAIAHILPTL 265
            ...:.|:...:|.|:|:|:...:.:.||.:|.|::..|........|..:|.|.|
  Rat   257 QQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPIL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 31/155 (20%)
TBP 191..267 CDD:278767 17/74 (23%)
TbpNP_001004198.1 PLN00062 141..317 CDD:177693 38/198 (19%)
TBP_eukaryotes 141..314 CDD:239952 38/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.