DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr68a

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:391 Identity:93/391 - (23%)
Similarity:144/391 - (36%) Gaps:99/391 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RRLSRLVLWLQFLGWLT-----WFISMWTQSVIYAQ----TIDCTLDCSLRHILTFFQTVSHAFI 85
            |...|||..:..:|.||     .|.|...:.|..||    .|:.|::       |....:|:..:
  Fly    38 RWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIE-------TLLCIISYTMV 95

  Fly    86 VVTSFLDG---FRIKQD--QLDEPI---AFEDSDPWLAFTVL-------AMLVPTLGVEYLVCSN 135
            |::|..:.   ||...|  ::||.:   .|.::......|:|       .:.|....:.|.....
  Fly    96 VLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIG 160

  Fly   136 APEYAFRIRIYHLKTLPSFLALQVQIISFILEVMKVNIRVR----QTKLQLLILA--------RE 188
            |......:.||.|:.|.|.|      ::..|..:.:|:..|    ..||....|.        ||
  Fly   161 AKRQIILLLIYFLQLLYSTL------LALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRE 219

  Fly   189 LS------CRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFV 247
            ||      |::                           .|:...||...|.|||......|....
  Fly   220 LSNLIEVLCKF---------------------------RYITENINCVAGVSLLFYFGFSFYTVT 257

  Fly   248 SNSYWLFVDI-------RTRPWRIYAILLNLGFIFNVA--LQMAAACWHCQQSYNLGRQIGCLIS 303
            :.||..|..:       :|.    .|..:.|..|:.:|  :.|...|..|.   .|..::.....
  Fly   258 NQSYLAFATLTAGSLSSKTE----VADTIGLSCIWVLAETITMIVICSACD---GLASEVNGTAQ 315

  Fly   304 KLVKPQG-SKLYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAER 367
            .|.:..| ||.:.:|:.:|..:::.|....||..|||::...|..:|:||.|||||||||...|.
  Fly   316 ILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLED 380

  Fly   368 S 368
            |
  Fly   381 S 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 60/248 (24%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 91/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.