DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr66a

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:169 Identity:32/169 - (18%)
Similarity:77/169 - (45%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RVKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYWLF--VDIRTRPWRI------Y 265
            ::.:|.:.::::..:...:|..:...:|:::...|.||.:..|:|:  ...::.|...      :
  Fly   320 KLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIPSLFRSAKNPF 384

  Fly   266 AILLNLGFIFNVALQMAAACWHCQQSYNLGRQIGCLISKLVKPQGSKLYNDLVSEFSLQTLHQRF 330
            ..::.|.:.....:.:....|...|:   .::.|..:.|........|..::|:..||:.|:...
  Fly   385 ITVIVLSYTSGKCVYLIYLSWKTSQA---SKRTGISLHKCGVVADDNLLYEIVNHLSLKLLNHSV 446

  Fly   331 VVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAERSS 369
            ..:|..||:|::..|..:...:.:||:|||||..|.:.:
  Fly   447 DFSACGFFTLDMETLYGVSGGITSYLIILIQFNLAAQQA 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 29/160 (18%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 29/160 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.