DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr8a

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:397 Identity:71/397 - (17%)
Similarity:133/397 - (33%) Gaps:117/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FILVAFSLRSRRLSRLVLWLQFLG---------------WLTWFISMWTQSVIYAQTIDCTLDCS 69
            |:|::       ||.|||...|.|               .|.:..:......||.:|:.     |
  Fly    45 FLLIS-------LSALVLACLFSGEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLS-----S 97

  Fly    70 LRHILTFFQTVSHAFIVVTSFLDGFRIKQDQLDEPIAFEDSDPWLAFTVLAMLVPTLGVE----- 129
            .||:..|:                                   ||.|.:.......:.:.     
  Fly    98 QRHLANFW-----------------------------------WLHFKLGGQKTGLVSLRSEFQQ 127

  Fly   130 ------YLVCSNAPEYAFRIRIYHLKTLPSFLAL------------QVQIISFILEVMKVNIRVR 176
                  :|....|.|.|..:.::..:.|...:.|            .::.:.|:|.:..:..::.
  Fly   128 FCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELLREQLT 192

  Fly   177 QTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIII- 240
            ..:.::.:||..........:..|.|......|:...:|.|:.::.:.....|.|..|:|.::: 
  Fly   193 GLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLT 257

  Fly   241 -----------VHFAIF---VSNSYWLFVDIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQQS 291
                       ::::|:   ::|.|:|.|.         |:|....||:.....|........|.
  Fly   258 INIRIAVDCYFMYYSIYNNVINNDYYLIVP---------ALLEIPAFIYASQSCMVVVPRIAHQL 313

  Fly   292 YNLGRQIGCLISKLVKPQGSKLYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYL 356
            :|:....||.....:..|        :..||||.|||...:.......|:..||:.|..:|.||:
  Fly   314 HNIVTDSGCCSCPDLSLQ--------IQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYM 370

  Fly   357 VILIQFM 363
            :..|||:
  Fly   371 IYSIQFI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 45/247 (18%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 69/394 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.