DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr36b

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:420 Identity:74/420 - (17%)
Similarity:139/420 - (33%) Gaps:146/420 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WTQSVIYAQTIDCTL--------DCSLRHIL-----TFFQTVSHAFIVVTSFLDGFRIKQDQLDE 103
            |...::.|..|.|.|        ||....:.     |.:..:::.||::| .:..|....   |.
  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILIT-IIYNFTAHG---DT 64

  Fly   104 PIAFEDSDPWLAFTVLAM--------LVPTL------GVEYLVCSNAPEYAFRIRIY----HLKT 150
            .:.|:.::....:.::.|        |:..|      |....:..:.      ||:|    .||:
  Fly    65 NLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDV------IRLYMINPQLKS 123

  Fly   151 LPSFLALQVQIISFILEVMKVNI------------------------------------------ 173
            :..:..|....|||.:|:::|.:                                          
  Fly   124 MIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRA 188

  Fly   174 --RVRQTKLQLLI-LARELS------------CRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYL 223
              |:...||:::| .:|.||            |.:        .|||    ::|:....:.|..:
  Fly   189 QYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCY--------LSDQ----LEDIGEVQSQLQSM 241

  Fly   224 FVRINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWR---------IYAILLNLGFIFNVAL 279
            ..:::..||...|.....::...|..||..:...:..|..         |..||:.|.::     
  Fly   242 VGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYL----- 301

  Fly   280 QMAAACWHCQQSYNLGRQ-------IGCLISKLVKPQGSKLYNDLVSEFSLQTLHQRFV-----V 332
               .|..:|.   |:.|.       :|.|..:.|  ..|.|  |:..|.|.::|..:..     :
  Fly   302 ---DALVNCN---NMLRVLDHHKDFLGLLEERTV--FASSL--DIRLEESFESLQLQLARNPLKI 356

  Fly   333 TAKDFFSLNLHLLSSMFAAVVTYLVILIQF 362
            .....|.:.....::|.|:|:...:.||||
  Fly   357 NVMGMFPITRGSTAAMCASVIVNSIFLIQF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 54/302 (18%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 73/415 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.