DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr59a

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:284 Identity:56/284 - (19%)
Similarity:88/284 - (30%) Gaps:138/284 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RIYHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKLQ--------LLI---------------- 184
            |::.|||    ..|....:|:||.|.     :.|.|.|        ||:                
  Fly   125 RMFFLKT----FTLTYSCLSYILAVF-----IYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFT 180

  Fly   185 ----LARELSCRWPQRKQKPQFSDQQAHRV-----KDLKRR----------YNDLHYLFVRINGY 230
                :||..           .|.:||.:.:     .||:|:          :.:|.|...|||.:
  Fly   181 SLWHIARGY-----------DFVNQQLNEIVACQSMDLERKSKELRGLWALHRNLSYTARRINKH 234

  Fly   231 FGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQQSYNLG 295
            :|..:|.:...:|...:.|:.                   :|.|::...|..:            
  Fly   235 YGPQMLAMRFDYFIFSIINAC-------------------IGTIYSTTDQEPS------------ 268

  Fly   296 RQIGCLISKLVKPQGSKLY-------------NDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSS 347
                     |.|..||.:|             .|||||:.:|          ..||:..    ||
  Fly   269 ---------LEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQ----------PKFFAPE----SS 310

  Fly   348 MFAAVVTYLVILIQFMFAERSSTR 371
            |...:.:||:.        .||||
  Fly   311 MSNELSSYLIY--------ESSTR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 52/273 (19%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 56/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.