DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr22f

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:403 Identity:83/403 - (20%)
Similarity:137/403 - (33%) Gaps:124/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTWFISMWTQSVIYAQTI----DCTLDCSLRHI-----LTFFQTVSHAFIVVTSFLDGFRIKQDQ 100
            |.||:   .|:.:||..:    ..|.|...:.:     |..:..|.|:..:..:.......||.:
  Fly    14 LAWFM---LQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRR 75

  Fly   101 LDEPIAFEDS------------------------DPWLAFTVLAMLVPTLGVE-----YLVCSNA 136
              :..|||.:                        :.|.:.||..:....|.:|     .|...|.
  Fly    76 --KYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNC 138

  Fly   137 PEY-------------AFRIRIYH--------------LKTLPSFLALQVQIISFILEVMKVNIR 174
            |.:             .|.|.||.              |..||| :.||:.|:.|..|::.|   
  Fly   139 PNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPS-VGLQLIIMHFHTEIILV--- 199

  Fly   175 VRQTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTII 239
                 .:.:.|..|      ..:.....|..:.|.:..|..|...|..|.|..|.      |.:|
  Fly   200 -----YRYVWLVNE------TLEDSHHLSSSRIHALASLYDRLLKLSELVVACND------LQLI 247

  Fly   240 IVHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNVAL-QMAAACWH-------CQQSYNLGR 296
            ::.....:.|:..:|..|      :..:.:|..:|:.||. |:....|.       |    :|..
  Fly   248 LMLIIYLIGNTVQIFFLI------VLGVSMNKRYIYLVASPQLIINFWDFWLNIVVC----DLAG 302

  Fly   297 QIGCLISKLVKPQGSKLYNDL----------VSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAA 351
            :.|...||::     ||:.||          ::||:....|::|.......||:|.::...|...
  Fly   303 KCGDQTSKVL-----KLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIIT 362

  Fly   352 VVTYLVILIQFMF 364
            ...|||.|:||.|
  Fly   363 SFLYLVYLLQFDF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 56/252 (22%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 80/395 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.