DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr39b

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:375 Identity:96/375 - (25%)
Similarity:157/375 - (41%) Gaps:54/375 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ASSRVVLKIFHFILVAFSLRSRRLSRLVLWLQFLGWLTWFISMWTQSVIYAQTIDCTLDCSLR-- 71
            |.|:.|.|::..||:..:.....:|     :.|......|:|:....:::...|.|.....|:  
  Fly    25 AQSKFVQKVYSAILIILNAVHFGIS-----IYFPQSAELFLSLMVNVIVFVARIVCVTVIILQVM 84

  Fly    72 -HILTFFQTVSHAFIVVTSFLDGFRIKQDQLDEPIAFEDSDPWLAFT-VLAM----LVPTLGVEY 130
             |...:|:     |.....:| |.|: |.:|...:.   ...|.::. :||:    ||..|...|
  Fly    85 VHYDDYFR-----FCREMKYL-GLRL-QCELKIHVG---RLKWQSYAKILALGIGFLVTVLPSIY 139

  Fly   131 LVCSNAPEYAFRIRIYHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKLQLLILARELSCRWPQ 195
            :..|.:       .:|...:|.|.|.:::|   |:|.::.|.:......|..:.|...|.|....
  Fly   140 VALSGS-------LLYFWSSLLSILIIRMQ---FVLVLLNVELLGHHVSLLGIRLQNVLECHLMG 194

  Fly   196 RKQKPQFSDQQAHRVKD------LKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYW-- 252
            ....   .|..|:|:..      ||:.:..|||||...|..||.|:|...:|.|:....|.||  
  Fly   195 ANCT---LDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNIYWTQ 256

  Fly   253 -LFVDIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQ-QSYNLG---RQIGCLISKLVKPQGSK 312
             :.|::....:......:.:...||: |........|| ||..:|   |.:.|..|  :..:.| 
  Fly   257 QVLVEVYEYKYLYATFSVFVPSFFNI-LVFCRCGEFCQRQSVLIGSYLRNLSCHPS--IGRETS- 317

  Fly   313 LYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQF 362
             |.||:.||.||.......:.|:.|.|.:..||.|:.||.||||::|:||
  Fly   318 -YKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 65/233 (28%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 96/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019803
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.