DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr23a and Gr59d

DIOPT Version :9

Sequence 1:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster


Alignment Length:169 Identity:31/169 - (18%)
Similarity:72/169 - (42%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 AHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPW--RIYAILL 269
            |.|::.:.:..:||..|...::..:.|.::.::|.::...:..||.||...:...:  .:..|:.
  Fly   224 ADRLERIAKSQSDLQELVENLSTAYEGEVVCLVITYYLNMLGTSYLLFSISKYGNFGNNLLVIIT 288

  Fly   270 NLG---FIFNVALQMAAACWHCQQSYNL-------GRQIGCLISKLVKPQGSKLYNDLVSE-FSL 323
            ..|   |:|.|     ..||  ..::|:       .:.:..|..:.:...|.....::|.| |:|
  Fly   289 LCGIVYFVFYV-----VDCW--INAFNVFYLLDAHDKMVKLLNKRTLFQPGLDHRLEMVFENFAL 346

  Fly   324 QTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQF 362
            ..:.....:.....|........::|.:::|:.::|||:
  Fly   347 NLVRNPLKLHMYGLFEFGRGTSFAVFNSLLTHSLLLIQY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 30/167 (18%)
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 31/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.