DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and SPT15

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_011075.3 Gene:SPT15 / 856891 SGDID:S000000950 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:50/258 - (19%)
Similarity:99/258 - (38%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EELKISKESSAKEDLVTEPMKTESYLYKDYFNKSPIDFPWEKAYEKGSSLGPDFYIDYENIFDNV 109
            |.||..||::   .:|.:|            |...:   ||.....|:.....|..:     :::
Yeast     5 ERLKEFKEAN---KIVFDP------------NTRQV---WENQNRDGTKPATTFQSE-----EDI 46

  Fly   110 ANLAEIEEK-------LELHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSA 167
            ...|...||       :....:.....:...||..:..:.|....:.::|....:|:::|..|..
Yeast    47 KRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKT 111

  Fly   168 QVKIHAGGKISST-ALNADSARSGLFKVIRILQDLDYKVDIMNFS-KNIVNASFSMPFKIDLDLM 230
            ...|.|.||:..| |.:.|.::....|..||:|.:.:.....:|. :||| .|..:.|.|.|:.:
Yeast   112 TALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIV-GSCDVKFPIRLEGL 175

  Fly   231 SRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            :..|....:......|.:.|......:...:|.:|.:::..:....|..:|.....|:|::.:
Yeast   176 AFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 17/72 (24%)
PLN00062 131..294 CDD:177693 35/165 (21%)
TBP 213..291 CDD:278767 16/77 (21%)
SPT15NP_011075.3 PLN00062 64..239 CDD:177693 35/176 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.905639 Normalized mean entropy S205
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.