DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and TBP

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_003185.1 Gene:TBP / 6908 HGNCID:11588 Length:339 Species:Homo sapiens


Alignment Length:261 Identity:54/261 - (20%)
Similarity:96/261 - (36%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EGTSAKLSSLDKLFEELKISKESSAKEDLVTEPMKTESYLYKDYFN-KSPIDFPWEKAYEKGSSL 94
            :|||.:   ..:||.          .:.|.|.|:...:.||..... .:||. |...|.| .|.:
Human   112 QGTSGQ---APQLFH----------SQTLTTAPLPGTTPLYPSPMTPMTPIT-PATPASE-SSGI 161

  Fly    95 GPDFYIDYENIFDNVANLAEIEEKLELHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVV 159
            .|..    :||...|                     :..|:..:..:.|....:.::|....:|:
Human   162 VPQL----QNIVSTV---------------------NLGCKLDLKTIALRARNAEYNPKRFAAVI 201

  Fly   160 VKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPF 223
            ::|..|.....|.:.||:..| |.:.:.:|....|..|::|.|.:....::|....:..|..:.|
Human   202 MRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKF 266

  Fly   224 KIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPI 288
            .|.|:.:...|....:......|.:.|......:...:|.:|.|::..:....|..||..|..||
Human   267 PIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPI 331

  Fly   289 L 289
            |
Human   332 L 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 14/72 (19%)
PLN00062 131..294 CDD:177693 34/160 (21%)
TBP 213..291 CDD:278767 17/77 (22%)
TBPNP_003185.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
polyglutamine repeat 58..95
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..159 10/33 (30%)
PLN00062 162..338 CDD:177693 38/196 (19%)
Repetitive region 165..241 17/100 (17%)
Repetitive region 255..332 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.905639 Normalized mean entropy S205
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.