DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and Tbpl2

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001092831.1 Gene:Tbpl2 / 680050 RGDID:1596837 Length:344 Species:Rattus norvegicus


Alignment Length:292 Identity:66/292 - (22%)
Similarity:114/292 - (39%) Gaps:43/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TSAKLSSL-DKLFEELKISKESSAKEDLVTEPMKTESYLYKDYFNKSPIDFPWEKAYEKGSSL-- 94
            :|..||.| |:|.:|   :|:.:...:.||   ..||:..:|:  :|.:..|    .|:||.|  
  Rat    63 SSVDLSFLPDELTQE---NKDRTVTGNKVT---NEESFRTQDW--QSQLQLP----DEQGSGLNL 115

  Fly    95 ----GPDFY-------IDYENIFDNVANLAEIEEKLELHFRPFTCVMDFN--------------- 133
                .||..       .|...:.....|...:...|.....|...|.:.:               
  Rat   116 NSNSSPDTQSCLCSHDADSNQLSSETPNSNALPVVLISSMTPMNPVTECSGIVPQLQNVVSTANL 180

  Fly   134 -CRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIR 196
             |:..:.::.|....:.::|....:|:::|..|.....|.:.||:..| |.:.|.:|....|..|
  Rat   181 ACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEDESRLAARKYAR 245

  Fly   197 ILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAV 261
            ::|.|.:.|...||....:.||..:.|.|.|::::..|....:......|.:.|......|...:
  Rat   246 VVQKLGFPVRFFNFKIQNMVASCDVKFPIRLEILALTHRQFSSYEPELFPGLIYKMVKPQVVLLI 310

  Fly   262 FPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            |.:|.|::..:....|..||..|..|||...|
  Rat   311 FASGKVVLTGAKERSEIYEAFENMYPILESFK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 16/88 (18%)
PLN00062 131..294 CDD:177693 40/180 (22%)
TBP 213..291 CDD:278767 19/77 (25%)
Tbpl2NP_001092831.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..143 15/73 (21%)
PLN00062 168..344 CDD:177693 40/175 (23%)
TBP_eukaryotes 168..341 CDD:239952 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.