DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tbpl1

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_991285.1 Gene:tbpl1 / 403035 ZFINID:ZDB-GENE-040520-2 Length:186 Species:Danio rerio


Alignment Length:143 Identity:41/143 - (28%)
Similarity:60/143 - (41%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSM 221
            |::|:..|.....|.:.|||..| |.:.:.|:.|..::.|.||.:.:||...:|....|.|..||
Zfish    47 VLMKLRKPRITASIWSSGKIICTGATSEEEAKLGSRRLARCLQKMGFKVRFSDFKVVNVLAVCSM 111

  Fly   222 PFKIDLDLMSRRHVVEVAQNRSRRPFITYTTE----------NLGVRFAVFPTGFVLVLHSTSHC 276
            ||:|.|        :|..:|  .||..:|..|          ||.....||.||.:.|...... 
Zfish   112 PFQIRL--------IEFTKN--NRPIASYEPELHPAASYRIKNLRSTVQVFSTGNITVTGPNVQ- 165

  Fly   277 ETREAIANFLPIL 289
            ....|:....|:|
Zfish   166 SVASAVEEIYPLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 13/42 (31%)
PLN00062 131..294 CDD:177693 41/143 (29%)
TBP 213..291 CDD:278767 24/87 (28%)
tbpl1NP_991285.1 TLF 9..180 CDD:239953 41/143 (29%)
PLN00062 15..184 CDD:177693 41/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.