DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and Trf5

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster


Alignment Length:303 Identity:92/303 - (30%)
Similarity:150/303 - (49%) Gaps:24/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VKLKEGTSAKLSSLDKLFEELKIS---KESSAKEDLVTEPMKTESYLYKDYFNKSPIDFPWEKAY 88
            :|.|...:|.:|. ..|.|:.|:|   ::.|.::.|..:..:....:      ..||..|.|...
  Fly    18 IKTKVMKTASMSR-KTLLEDAKLSTSDQDPSDRQVLANKASEGAEEM------SLPIVNPREPTL 75

  Fly    89 EKGSSLGPDFYIDYENIFDNVANLAEIEEKLELHFRPFTCVMDFNCRFSMYELCLLLAESRFDPS 153
            :           |..:|::||:.|.:|:..|.:.::||.|:.....:|.:.||.:.|..:.|:|.
  Fly    76 K-----------DVLSIYENVSKLGDIQRYLNVIYKPFYCLAMTTSKFHLLELDMGLKNTAFEPE 129

  Fly   154 SHPSVVVKITHPSAQVKIHAGGKISSTALNADSARSGLFKVIRILQDLDYKVDIMNFSKNIVNAS 218
            .|.::.|....|:..::|:..|.|...|...:|||.||..:::.|:.|.|...:.....|.|||:
  Fly   130 KHMALFVYRYSPTRSIRIYPHGNIYCQAFCKNSARYGLANILKELRYLGYAPRLRRLKTNAVNAT 194

  Fly   219 FSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIA 283
            ||:||.::|......:.|....:.|:.||:.|......|..|:||||:|:||.:|:...|:.|||
  Fly   195 FSVPFNLNLRQFHLENPVVTRYDTSKYPFLVYKMMGTTVEIAIFPTGYVIVLFATTMEITKLAIA 259

  Fly   284 NFLPILAKLKNGYPTAEEKLGQLVGDISYKLFWEK--QLEDDK 324
            :.||.|.:||:.| ..:.||....|||.|||.||.  |...||
  Fly   260 HILPTLYRLKDPY-QEQCKLSHSSGDIDYKLLWENHFQKNGDK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 20/71 (28%)
PLN00062 131..294 CDD:177693 53/162 (33%)
TBP 213..291 CDD:278767 31/77 (40%)
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 51/154 (33%)
TBP 191..267 CDD:278767 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019506
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.