DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tbp1

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_594566.1 Gene:tbp1 / 2541582 PomBaseID:SPAC29E6.08 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:45/227 - (19%)
Similarity:89/227 - (39%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 YFNKSPIDFPW-----EKAYEKGSSLGPDFYIDYENIFDNVANLAEIEEKLELHFRPFTCVMDFN 133
            :.|.|.:.||.     .:|..:.:..|.......|.:...|..|..|           ...::.:
pombe    15 FMNNSSLTFPVLPNANNEATNETADSGDAEVSKNEGVSGIVPTLQNI-----------VATVNLD 68

  Fly   134 CRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGK-ISSTALNADSARSGLFKVIRI 197
            ||..:..:.|....:.::|....:|:::|..|.:...|.|.|| :.....:.|.::....|..||
pombe    69 CRLDLKTIALHARNAEYNPKRFAAVIMRIREPKSTALIFASGKMVVLGGKSEDDSKLASRKYARI 133

  Fly   198 LQDLDYKVDIMNFS-KNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAV 261
            :|.|.:.....:|. :||| .|..:.|.|.|:.::..|....:......|.:.|......|...:
pombe   134 IQKLGFNAKFTDFKIQNIV-GSCDVKFPIRLEGLAYSHGTFSSYEPELFPGLIYRMVKPKVVLLI 197

  Fly   262 FPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            |.:|.:::..:....|..:|.....|:|::.:
pombe   198 FVSGKIVLTGAKVREEIYQAFEAIYPVLSEFR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 15/72 (21%)
PLN00062 131..294 CDD:177693 35/165 (21%)
TBP 213..291 CDD:278767 17/77 (22%)
tbp1NP_594566.1 PLN00062 55..230 CDD:177693 38/187 (20%)
TBP_eukaryotes 55..228 CDD:239952 38/184 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.