DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and Tbpl1

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_035733.1 Gene:Tbpl1 / 237336 MGIID:1339946 Length:186 Species:Mus musculus


Alignment Length:158 Identity:38/158 - (24%)
Similarity:70/158 - (44%) Gaps:2/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AEIEEKLELHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKI 177
            |:.:..|::......||....|..::.::.|..|...: ......|::|:..|.....|.:.|||
Mouse     3 ADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIY-KRDVGKVLMKLRKPRITATIWSSGKI 66

  Fly   178 SST-ALNADSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQN 241
            ..| |.:.:.|:.|..::.|.||.|.::|...:|....|.|..:|||:|.|...::.:....:..
Mouse    67 ICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYE 131

  Fly   242 RSRRPFITYTTENLGVRFAVFPTGFVLV 269
            ....|.:.|..::|.....:|.||.:.|
Mouse   132 PELHPAVCYRIKSLRATLQIFSTGSITV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 18/72 (25%)
PLN00062 131..294 CDD:177693 34/140 (24%)
TBP 213..291 CDD:278767 14/57 (25%)
Tbpl1NP_035733.1 TLF 9..180 CDD:239953 37/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.