DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and Tbpl2

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_951014.1 Gene:Tbpl2 / 227606 MGIID:2684058 Length:350 Species:Mus musculus


Alignment Length:297 Identity:65/297 - (21%)
Similarity:115/297 - (38%) Gaps:36/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GVKLKEGTSAKLSSLDKLFEELKISKESSAKEDLVT--EPMKTESYLYKDYFNKSPIDFPWEKAY 88
            |||   ..|...||:|..|...::::|:  ::..||  :....||...:|  .:|.:..|.|...
Mouse    59 GVK---KASTDFSSVDLSFLPDELTQEN--RDQTVTGNKLASEESCRTRD--RQSQLQLPDEHGS 116

  Fly    89 E----KGSSLGPDFYIDYENIFDN-----VANLAEIEEKLELHFRPFTCVMDFN----------- 133
            |    ..||..|...:.:::...|     ..|...:...|.....|...|..|:           
Mouse   117 ELNLNSNSSPDPQSCLCFDDAHSNQPSPETPNSNALPVALIASMMPMNPVPGFSGIVPQLQNVVS 181

  Fly   134 -----CRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLF 192
                 |:..:.::.|....:.::|....:|:::|..|.....|.:.||:..| |.:.:.:|....
Mouse   182 TANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEESRLAAR 246

  Fly   193 KVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRH-VVEVAQNRSRRPFITYTTENLG 256
            |..|::|.|.:.|...||....:..|..:.|.|.|::::..| ....:......|.:.|......
Mouse   247 KYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSSYEPELFPGLIYKMVKPQ 311

  Fly   257 VRFAVFPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            |...:|.:|.|::..:....|..||..|..|||...|
Mouse   312 VVLLIFASGKVVLTGAKERSEIYEAFENMYPILESFK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 16/88 (18%)
PLN00062 131..294 CDD:177693 39/181 (22%)
TBP 213..291 CDD:278767 18/78 (23%)
Tbpl2NP_951014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..150 15/71 (21%)
PLN00062 173..350 CDD:177693 38/176 (22%)
TBP_eukaryotes 173..347 CDD:239952 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.