DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and Tbp

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_038712.3 Gene:Tbp / 21374 MGIID:101838 Length:316 Species:Mus musculus


Alignment Length:235 Identity:49/235 - (20%)
Similarity:88/235 - (37%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EDLVTEPMKTESYLYKDYFN-KSPIDFPWEKAYEKGSSLGPDFYIDYENIFDNVANLAEIEEKLE 120
            :.|.|.|:...:.||..... .:||. |...|.| .|.:.|..    :||...|           
Mouse   102 QTLTTAPLPGTTPLYPSPMTPMTPIT-PATPASE-SSGIVPQL----QNIVSTV----------- 149

  Fly   121 LHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNA 184
                      :..|:..:..:.|....:.::|....:|:::|..|.....|.:.||:..| |.:.
Mouse   150 ----------NLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSE 204

  Fly   185 DSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFIT 249
            :.:|....|..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......|.:.
Mouse   205 EQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLI 269

  Fly   250 YTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |......:...:|.:|.|::..:....|..||..|..|||
Mouse   270 YRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPIL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 14/72 (19%)
PLN00062 131..294 CDD:177693 34/160 (21%)
TBP 213..291 CDD:278767 17/77 (22%)
TbpNP_038712.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..135 10/32 (31%)
PLN00062 139..315 CDD:177693 38/196 (19%)
TBP_eukaryotes 139..312 CDD:239952 38/196 (19%)
Repetitive region 142..218 17/100 (17%)
Repetitive region 232..309 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.905639 Normalized mean entropy S205
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.