DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and Tbp

DIOPT Version :10

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_038712.3 Gene:Tbp / 21374 MGIID:101838 Length:316 Species:Mus musculus


Alignment Length:235 Identity:49/235 - (20%)
Similarity:88/235 - (37%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EDLVTEPMKTESYLYKDYFN-KSPIDFPWEKAYEKGSSLGPDFYIDYENIFDNVANLAEIEEKLE 120
            :.|.|.|:...:.||..... .:||. |...|.| .|.:.|..    :||...|           
Mouse   102 QTLTTAPLPGTTPLYPSPMTPMTPIT-PATPASE-SSGIVPQL----QNIVSTV----------- 149

  Fly   121 LHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNA 184
                      :..|:..:..:.|....:.::|....:|:::|..|.....|.:.||:..| |.:.
Mouse   150 ----------NLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSE 204

  Fly   185 DSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFIT 249
            :.:|....|..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......|.:.
Mouse   205 EQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLI 269

  Fly   250 YTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |......:...:|.:|.|::..:....|..||..|..|||
Mouse   270 YRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPIL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP_TLF 131..>234 CDD:447593 21/103 (20%)
TBP 213..292 CDD:425630 17/77 (22%)
TbpNP_038712.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..135 10/32 (31%)
PLN00062 139..315 CDD:177693 38/196 (19%)
Repetitive region 142..218 17/100 (17%)
Repetitive region 232..309 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.