DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tbp-1

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001370645.1 Gene:tbp-1 / 176054 WormBaseID:WBGene00006542 Length:340 Species:Caenorhabditis elegans


Alignment Length:165 Identity:34/165 - (20%)
Similarity:68/165 - (41%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 MDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFK 193
            ::...:..:.::.|....:.::|....:|:::|..|.....|.:.||:..| |.:.:::|....|
 Worm   175 VNLGVQLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEASRLAARK 239

  Fly   194 VIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVR 258
            ..||:|.|.::.....|....:..|..:.|.|.|:.:...|...........|.:.|......|.
 Worm   240 YARIVQKLGFQAKFTEFMVQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVKPRVV 304

  Fly   259 FAVFPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            ..:|.:|.|::..:.:..:..||.....|||...|
 Worm   305 LLIFVSGKVVITGAKTKRDIDEAFGQIYPILKGFK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 14/70 (20%)
PLN00062 131..294 CDD:177693 34/164 (21%)
TBP 213..291 CDD:278767 16/77 (21%)
tbp-1NP_001370645.1 TBP_eukaryotes 165..338 CDD:239952 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.905639 Normalized mean entropy S205
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.