DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tlf-1

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001122474.1 Gene:tlf-1 / 172676 WormBaseID:WBGene00006577 Length:508 Species:Caenorhabditis elegans


Alignment Length:148 Identity:29/148 - (19%)
Similarity:63/148 - (42%) Gaps:10/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PSAQVKIHAGGKISSTALNAD-----SARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFK 224
            |...:|:::.||:......::     :|||....|.|::.....:|.|.|:..|.|.|:..:||.
 Worm   311 PGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFG 375

  Fly   225 IDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |.::.::.::..|..........:.:.:........:..||.:.|..:.|..:..|.::...||:
 Worm   376 IKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIV 440

  Fly   290 AKLK-----NGYPTAEEK 302
            .:.:     .|...|::|
 Worm   441 LEFRCLERAKGNVAAQKK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 9/39 (23%)
PLN00062 131..294 CDD:177693 26/138 (19%)
TBP 213..291 CDD:278767 14/77 (18%)
tlf-1NP_001122474.1 Med15 <3..>218 CDD:312941
KLF1_2_4_N <183..217 CDD:425360
TLF 266..442 CDD:239953 26/130 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.905639 Normalized mean entropy S205
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.