DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PUP3

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:35/186 - (18%)
Similarity:68/186 - (36%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLYK 70
            ::.:.|.|.|.:|.|.......:.:.:...||...... .:...|...|.....:......:|||
Yeast    12 VVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHV-FLGITGLATDVTTLNEMFRYKTNLYK 75

  Fly    71 ISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEG-PDLHYIDSYGA---AQSINH 131
            :.....:..::.......:|  |.|....|.|..::||.::..| |.:...|..|.   |:....
Yeast    76 LKEERAIEPETFTQLVSSSL--YERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIV 138

  Fly   132 AGHGWGSMF--CGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVV 185
            :|.....:|  |.|:    :...|..||.:..:.:.:|....|..::.....||::
Yeast   139 SGTASDQLFGMCESL----YEPNLEPEDLFETISQALLNAADRDALSGWGAVVYII 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 35/186 (19%)
proteasome_beta_type_2 3..194 CDD:239727 35/186 (19%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 35/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.