DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PRE6

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_014604.1 Gene:PRE6 / 854119 SGDID:S000005398 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:44/213 - (20%)
Similarity:80/213 - (37%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AMETI------LGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTD 60
            |:|.:      :|:||.:.|:|..:......|...:...||:.::....:::..|...|:   ..
Yeast    23 ALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADS---RI 84

  Fly    61 FISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTN--TRY-----------------QVAMLL 106
            .|.|              |:..|...|.||.|.:...  |||                 .|:.|:
Yeast    85 LIEK--------------ARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLI 135

  Fly   107 AGYDAVEG-PDLHYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSK---LSQEDAYSLMKKCVL 167
            ||:|..:. |.|:..:..|...|.:....|..|......|::.::.|   .:.|:...|..:.:|
Yeast   136 AGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLL 200

  Fly   168 EIQRRLIINQRNFEVYVV 185
            |:.:   ...:|.|:.||
Yeast   201 EVVQ---TGAKNIEITVV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 44/213 (21%)
proteasome_beta_type_2 3..194 CDD:239727 43/212 (20%)
PRE6NP_014604.1 proteasome_alpha_type_7 4..215 CDD:239724 42/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.