DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PUP2

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_011769.1 Gene:PUP2 / 853168 SGDID:S000003485 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:26/94 - (27%)
Similarity:44/94 - (46%) Gaps:10/94 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 YQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKK 164
            :.||:|:||:||.:|..|.:.:..|.....|....|.||....:.|...|:|.|:.::|..|:.|
Yeast   138 FGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLK 202

  Fly   165 CVLEI----------QRRLIINQRNFEVY 183
            .:.::          |...|..|..|::|
Yeast   203 ILKQVMEEKLDENNAQLSCITKQDGFKIY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 26/94 (28%)
proteasome_beta_type_2 3..194 CDD:239727 26/94 (28%)
PUP2NP_011769.1 proteasome_alpha_type_5 8..222 CDD:239722 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.