Sequence 1: | NP_001259950.1 | Gene: | Prosbeta4R2 / 33451 | FlyBaseID: | FBgn0031443 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571870.2 | Gene: | psma6l / 83917 | ZFINID: | ZDB-GENE-010502-2 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 71/195 - (36%) | Gaps: | 70/195 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TILGIKGPDFVML-----ASDT-MQAKSLVFM---------------KDDQSKIHRLSDFNMMAT 48
Fly 49 VGDGGDTIQFTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLA 107
Fly 108 GYDAVEGPDLHYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRR 172
Fly 173 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4R2 | NP_001259950.1 | PRE1 | 1..194 | CDD:223711 | 40/195 (21%) |
proteasome_beta_type_2 | 3..194 | CDD:239727 | 40/195 (21%) | ||
psma6l | NP_571870.2 | PRE1 | 7..252 | CDD:223711 | 40/195 (21%) |
proteasome_alpha_type_6 | 8..226 | CDD:239723 | 40/195 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |