DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PBD1

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_188902.1 Gene:PBD1 / 821834 AraportID:AT3G22630 Length:204 Species:Arabidopsis thaliana


Alignment Length:189 Identity:72/189 - (38%)
Similarity:113/189 - (59%) Gaps:1/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 METILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67
            ||.:.|:.|..|.::|:||....|::..|:::.||..|....::|..|:.||.:|||:::.||:.
plant     1 MECVFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYVQKNVS 65

  Fly    68 LYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHA 132
            |||..:|..|:..:||:|||..||..:|.|. |.|.:|:||||...|..|:|||.......::..
plant    66 LYKFRNGIPLTTAAAANFTRGELATALRKNP-YSVNILMAGYDDESGASLYYIDYIATLHKVDKG 129

  Fly   133 GHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMR 191
            ..|:||.|..|.:.|::.|.:|.|:|..|:.||:|||:.||::...||.:.:||..|.|
plant   130 AFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCILEIRSRLVVAPPNFVIKIVDKDGAR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 72/189 (38%)
proteasome_beta_type_2 3..194 CDD:239727 72/189 (38%)
PBD1NP_188902.1 proteasome_beta_type_2 1..192 CDD:239727 72/189 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1496
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1634
OMA 1 1.010 - - QHG53714
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - mtm1116
orthoMCL 1 0.900 - - OOG6_102061
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.