Sequence 1: | NP_001259950.1 | Gene: | Prosbeta4R2 / 33451 | FlyBaseID: | FBgn0031443 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780413.1 | Gene: | Psmb11 / 73902 | MGIID: | 1921152 | Length: | 302 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 42/200 - (21%) |
---|---|---|---|
Similarity: | 74/200 - (37%) | Gaps: | 17/200 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ETILGIKGPDF--------------VMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGD 54
Fly 55 TIQFTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHY 119
Fly 120 IDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYV 184
Fly 185 VDSKG 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4R2 | NP_001259950.1 | PRE1 | 1..194 | CDD:223711 | 41/199 (21%) |
proteasome_beta_type_2 | 3..194 | CDD:239727 | 41/199 (21%) | ||
Psmb11 | NP_780413.1 | 20S_bact_beta | 48..253 | CDD:163402 | 36/187 (19%) |
proteasome_beta_type_5 | 50..237 | CDD:239730 | 36/185 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |