DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Psmb11

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus


Alignment Length:200 Identity:42/200 - (21%)
Similarity:74/200 - (37%) Gaps:17/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETILGIKGPDF--------------VMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGD 54
            :|.|.|.||..              |:.|:||..:...........|:..:....:..|.|...|
Mouse    36 QTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHQRLLGTTSGTSAD 100

  Fly    55 TIQFTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHY 119
            ...:...:.:.|.|.::..|...|....|......::.|  ......||..|.|:|. .||.|.|
Mouse   101 CATWYRVLRRELRLRELREGQLPSVAGTAKLLAAMMSCY--RGLDLCVATALCGWDH-SGPALFY 162

  Fly   120 IDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYV 184
            :.|.|.....:....|.||.:...:|.|.::..::.::||:|.:..|.....|...:..:.:::.
Mouse   163 VYSDGTCLQGDIFSVGSGSPYAYGVLDRGYHYDMTIQEAYTLARCAVAHATHRDAYSGGSVDLFH 227

  Fly   185 VDSKG 189
            |...|
Mouse   228 VRESG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 41/199 (21%)
proteasome_beta_type_2 3..194 CDD:239727 41/199 (21%)
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 36/187 (19%)
proteasome_beta_type_5 50..237 CDD:239730 36/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.