Sequence 1: | NP_001259950.1 | Gene: | Prosbeta4R2 / 33451 | FlyBaseID: | FBgn0031443 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002790.1 | Gene: | PSMB7 / 5695 | HGNCID: | 9544 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 52/209 - (24%) |
---|---|---|---|
Similarity: | 95/209 - (45%) | Gaps: | 16/209 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
Fly 70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ----VAMLLAGYDAVEGPDLHYIDSYGAAQSIN 130
Fly 131 HAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEA 195
Fly 196 INPGSL-NKESISL 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4R2 | NP_001259950.1 | PRE1 | 1..194 | CDD:223711 | 48/192 (25%) |
proteasome_beta_type_2 | 3..194 | CDD:239727 | 48/192 (25%) | ||
PSMB7 | NP_002790.1 | proteasome_beta_type_7 | 44..232 | CDD:239732 | 48/197 (24%) |
Pr_beta_C | 236..271 | CDD:403609 | 3/7 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |