DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PSMB7

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_002790.1 Gene:PSMB7 / 5695 HGNCID:9544 Length:277 Species:Homo sapiens


Alignment Length:209 Identity:52/209 - (24%)
Similarity:95/209 - (45%) Gaps:16/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            ||.|:...|.::|.:||...:.:|....:.||||.:|........|...||...|..||.||.|:
Human    45 TIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELH 109

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ----VAMLLAGYDAVEGPDLHYIDSYGAAQSIN 130
            .:|.|......:|....::.|       .|||    .|::|.|.| |.||.|:.|..:|:...:.
Human   110 SLSTGRLPRVVTANRMLKQML-------FRYQGYIGAALVLGGVD-VTGPHLYSIYPHGSTDKLP 166

  Fly   131 HAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEA 195
            :...|.||:...::.:..:...:.:|:|.:|:.:.:.......:.:..|.::.|:..   .|::.
Human   167 YVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISK---NKLDF 228

  Fly   196 INPGSL-NKESISL 208
            :.|.:: ||:...|
Human   229 LRPYTVPNKKGTRL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 48/192 (25%)
proteasome_beta_type_2 3..194 CDD:239727 48/192 (25%)
PSMB7NP_002790.1 proteasome_beta_type_7 44..232 CDD:239732 48/197 (24%)
Pr_beta_C 236..271 CDD:403609 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.