DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PSMB2

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_002785.1 Gene:PSMB2 / 5690 HGNCID:9539 Length:201 Species:Homo sapiens


Alignment Length:195 Identity:86/195 - (44%)
Similarity:133/195 - (68%) Gaps:0/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 METILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67
            ||.::||:|||:|::|||.:.|.::|.||||..|:.::|:..::..||:.|||:||.::|.||:.
Human     1 MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    68 LYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHA 132
            |||:.:||.||..:||:|||:.|||.:|:.|.|.|.:||||||..|||.|:|:|...|......|
Human    66 LYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFA 130

  Fly   133 GHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAIN 197
            .||:|:....|||.||:...:|:|.|..|::||:.|:|:|.|:|...|.|.::|..|:..::.|:
Human   131 AHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNIS 195

  Fly   198  197
            Human   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 85/190 (45%)
proteasome_beta_type_2 3..194 CDD:239727 85/190 (45%)
PSMB2NP_002785.1 proteasome_beta_type_2 1..192 CDD:239727 85/190 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147325
Domainoid 1 1.000 200 1.000 Domainoid score I3035
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3566
Isobase 1 0.950 - 0 Normalized mean entropy S587
OMA 1 1.010 - - QHG53714
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm40860
orthoMCL 1 0.900 - - OOG6_102061
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.