DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and PSMA4

DIOPT Version :10

Sequence 1:NP_722823.2 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_002780.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:186 Identity:41/186 - (22%)
Similarity:72/186 - (38%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AME------TILGIKGPDFVMLASDTMQAKSL---VFMKDDQSKIHRLSDFNMMATVGDGGDTIQ 57
            |||      |.|||...|.|:||::......|   ||..:   ||::|::....:..|...|...
Human    24 AMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSE---KIYKLNEDMACSVAGITSDANV 85

  Fly    58 FTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLAGYDAVEGPD 116
            .|:.:......|.:.:...:..:...    ..|.|..:..|:      :.|::|..|:|...|..
Human    86 LTNELRLIAQRYLLQYQEPIPCEQLV----TALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQ 146

  Fly   117 LHYIDSYGAAQSINHAGHGWGSMFCGS--------ILQRYWNSKLSQEDAYSLMKK 164
            |:..|..|     |:.  ||.:...|:        :.|.|...:::.:.|.:|..|
Human   147 LYQSDPSG-----NYG--GWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_722823.2 proteasome_beta_type_2 3..194 CDD:239727 40/185 (22%)
PSMA4NP_002780.1 proteasome_alpha_type_4 3..216 CDD:239721 41/186 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.