DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and psma3

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001025358.1 Gene:psma3 / 564370 ZFINID:ZDB-GENE-050913-120 Length:255 Species:Danio rerio


Alignment Length:215 Identity:39/215 - (18%)
Similarity:76/215 - (35%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            |.:||:..|.|:...:.: ..|.::.:....:|..:.....||..|...|....::...:....:
Zfish    36 TAIGIRCKDGVVFGVEKL-VLSKLYEEGSNKRIFNIDRHVGMAVAGLLADARSLSEVAREEASSF 99

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQV------AMLLAGYDAVEGPDLHYIDSYGAAQS 128
            :.::|:.:..|..|    ..:|.|:...|.|..      :.:|..||..:||.|:.:|..|.|..
Zfish   100 RSNYGHDIPLKHLA----DRVAMYVHAYTLYSAVRPFGCSFILGSYDEDDGPQLYMVDPSGIAYG 160

  Fly   129 INHAGHGWGSMFCGSILQRYWN---SKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGM 190
                               ||.   .|..|.....:.|..:.::..|.::.:....:|:|..:..
Zfish   161 -------------------YWGCAIGKAKQAAKTEIEKLQMKDMTCRELVKEVAKIIYIVHDEVK 206

  Fly   191 RKMEAINPGSLNKESISLSW 210
            .|          ...:.|||
Zfish   207 DK----------AFELELSW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 36/197 (18%)
proteasome_beta_type_2 3..194 CDD:239727 36/197 (18%)
psma3NP_001025358.1 proteasome_alpha_type_3 5..217 CDD:239720 39/215 (18%)
PRE1 6..241 CDD:223711 39/215 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.