DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and psmb2

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001011057.1 Gene:psmb2 / 496467 XenbaseID:XB-GENE-946101 Length:199 Species:Xenopus tropicalis


Alignment Length:198 Identity:90/198 - (45%)
Similarity:136/198 - (68%) Gaps:1/198 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 METILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67
            ||.::||:|.|||::|:||:.|.|::.||.|..|:.::|:..::..||:.|||:||.::|.||:.
 Frog     1 MEYLIGIQGNDFVLVAADTVCANSIIKMKHDVDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    68 LYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHA 132
            |||:.:||.||..:||:|||:.||||:|:.|.|.|.:||||||..:||.|:|:|...|......|
 Frog    66 LYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYDEHDGPSLYYMDYLAALAKTRFA 130

  Fly   133 GHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAIN 197
            .||:|:....|||.||:...|::|||..|:|||:.|:|:|.|::..:|.|.|:|..|:..:|.| 
 Frog   131 AHGYGAYLTLSILDRYYKPDLTREDAVELLKKCIAELQKRFILSLPSFTVRVIDKDGIHDLETI- 194

  Fly   198 PGS 200
            |.|
 Frog   195 PAS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 86/190 (45%)
proteasome_beta_type_2 3..194 CDD:239727 86/190 (45%)
psmb2NP_001011057.1 proteasome_beta_type_2 1..192 CDD:239727 86/190 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2721
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm48058
Panther 1 1.100 - - O PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.