DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:197 Identity:35/197 - (17%)
Similarity:74/197 - (37%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            ||:.::....|::.:|:..:...........|:.|::|.......|...||....|.::.:|:  
  Fly    17 TIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSLN-- 79

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAML----LAGYDAVEGPDLHYIDSYGAAQSIN 130
                 ||.:..:......:..:::......|:.::|    :||:|...|..::.|...|.....:
  Fly    80 -----YHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRES 139

  Fly   131 HAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLE---------------------IQRRLI 174
            ....|.||.|....::.::...::.||..:.:||.|..                     |:||:.
  Fly   140 CTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIERRIF 204

  Fly   175 IN 176
            .|
  Fly   205 YN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 35/197 (18%)
proteasome_beta_type_2 3..194 CDD:239727 35/197 (18%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 32/190 (17%)
proteasome_beta_type_6 16..203 CDD:239731 33/192 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.