DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and psmb2

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:197 Identity:89/197 - (45%)
Similarity:134/197 - (68%) Gaps:0/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 METILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67
            ||.::||:|||||::|:|.:.|.|::.||.|..|:.:||:..::..||:.|||:||.::|.||:.
Zfish     1 MEYLIGIQGPDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    68 LYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHA 132
            |||:.:||.||..:||:||||.||||:|:.|.|.|.:||||||..:||.|:|:|...|......|
Zfish    66 LYKMRNGYELSPAAAANFTRKNLADYLRSRTPYHVNLLLAGYDETDGPGLYYMDYLSALAKAPFA 130

  Fly   133 GHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAIN 197
            .||:|:....|||.||:...|::|:|..|:|||:.|:.:|.|:|..:|.|.::|..|:..||.:.
Zfish   131 AHGYGAFLTLSILDRYYRPDLTREEAVDLLKKCLEELNKRFILNLPSFTVRLIDKDGIHDMEKLP 195

  Fly   198 PG 199
            .|
Zfish   196 VG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 86/190 (45%)
proteasome_beta_type_2 3..194 CDD:239727 86/190 (45%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 86/190 (45%)
PRE1 5..188 CDD:223711 83/182 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580858
Domainoid 1 1.000 210 1.000 Domainoid score I2770
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53714
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm26564
orthoMCL 1 0.900 - - OOG6_102061
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.