DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and psma8

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:223 Identity:48/223 - (21%)
Similarity:92/223 - (41%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQS--KIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67
            |.:||:|.|.|:|.   ::.||:..::::::  ||..|.:...||..|...|    ...:.....
Zfish    33 TAVGIRGKDIVVLG---VEKKSVAKLQEERTVRKICALDEHVCMAFAGLTAD----ARIVINRAR 90

  Fly    68 LYKISHGYHLSAKSAAHFTRKTLAD----YIRTNTR--YQVAMLLAGYDAVEGPDLHYIDSYGAA 126
            :...||...:.......:..:.:|.    |.::|.|  :.::.|:.|:|....|.|:..|..|..
Zfish    91 VECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFGISALIVGFDYDGTPRLYQTDPSGTY 155

  Fly   127 QSINHAGHGWGSMFCG-------SILQRYWNSK--LSQEDAYSLMKKCVLEIQR------RLIIN 176
                   |.|.:...|       ..|::.:..:  .|..||..|..|.:||:.:      .|.:.
Zfish   156 -------HAWKANAIGRSAKTVREFLEKNYTDEAIASDNDAIKLAIKALLEVVQSGGKNIELAVI 213

  Fly   177 QRNFEVYVVDSKGMRKMEAINPGSLNKE 204
            :||..:.:::||.:..:.|    .:.||
Zfish   214 RRNQPLKILESKEIETLVA----EIEKE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 45/211 (21%)
proteasome_beta_type_2 3..194 CDD:239727 45/211 (21%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 41/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.