DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:210 Identity:51/210 - (24%)
Similarity:93/210 - (44%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            ||:||...|.|:|.:||...:..:....:.:|||.|:........|...||...||.||..|.|:
  Fly    41 TIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELH 105

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ----VAMLLAGYDAVEGPDLHYIDSYGAAQSIN 130
            ::.....:...:|....::.|       .|||    .|::|.|.|.. ||.::.|..:|::..:.
  Fly   106 RLQTDREVRVVAANTMLKQML-------FRYQGHISAALVLGGVDKT-GPHIYSIHPHGSSDKLP 162

  Fly   131 HAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLE----------------IQRRLIINQRN 179
            :|..|.||:...::.:..|...||:|:...|::..:..                |::..:...||
  Fly   163 YATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYLRN 227

  Fly   180 FEVYVVDSKGMRKME 194
            :|  :.:.||.|:::
  Fly   228 YE--LANKKGKRQLD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 51/208 (25%)
proteasome_beta_type_2 3..194 CDD:239727 51/208 (25%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 47/199 (24%)
proteasome_beta_type_7 42..228 CDD:239732 45/193 (23%)
Pr_beta_C 232..264 CDD:289249 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441138
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.