DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Prosalpha3

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:227 Identity:55/227 - (24%)
Similarity:91/227 - (40%) Gaps:59/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AME------TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATV-GDGGDTIQFT 59
            |||      |.|||...|.::||::......|:.......||:||:| ||:.:| |...|....|
  Fly    24 AMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLND-NMVCSVAGITSDANVLT 87

  Fly    60 DFISKNLHLYKISHGYHLSAKS-AAHFTRKTLADYIRTNTRY------QVAMLLAGYDAVEGPDL 117
            ..:......|:.|:|..:..:. .:|     |.|..:..|:|      .|::|..|:|...|..|
  Fly    88 SELRLIAQRYQFSYGEVIPCEQLVSH-----LCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQL 147

  Fly   118 HYIDSYGAAQSINHAGHGW-----GSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQ 177
            :..|..|     |:.  ||     |:.|..:|      |.|.||                 :.::
  Fly   148 YQSDPSG-----NYG--GWKATCIGNNFGAAI------SMLKQE-----------------LADK 182

  Fly   178 RNFEVYVVDSKGMRKMEAINPGSLNKESISLS 209
            .|.::.:.|:|.:    ||...|:..::..|:
  Fly   183 ENVKLTLADAKDL----AIKVLSMTLDTTKLT 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 51/210 (24%)
proteasome_beta_type_2 3..194 CDD:239727 50/209 (24%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 55/227 (24%)
proteasome_alpha_type_4 3..219 CDD:239721 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.