DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:190 Identity:44/190 - (23%)
Similarity:74/190 - (38%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            |.:||..|:.|:||.: .:..|.:.:.....||..:......||.|...|.....:........:
  Fly    36 TAIGICTPEGVVLAVE-KRITSPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQNH 99

  Fly    70 KISHGYHLSAKSAAHFTRKTLA---------DYIRTNTR-YQVAMLLAGYDAVEGPDLHYIDSYG 124
            ...:...:|.:|.|... .|||         |.....:| :.||:|.||.:|.: |.|.::|..|
  Fly   100 WFVYNERMSIESCAQAV-STLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQ-PQLWHMDPSG 162

  Fly   125 AAQSINHAGH--GWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEV 182
            .  .:.|...  |.||......||..:...|:.::|..:....:.::.... :|..|.||
  Fly   163 T--FVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEK-LNSTNVEV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 44/190 (23%)
proteasome_beta_type_2 3..194 CDD:239727 44/190 (23%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 44/190 (23%)
proteasome_alpha_type_5 8..222 CDD:239722 44/190 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.