DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Prosalpha6

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:131 Identity:32/131 - (24%)
Similarity:56/131 - (42%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AMETI------LGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTD 60
            |||.:      :|:|..|:.:|.:   ..|....:.|.|.||..:.|...::..|...|....:.
  Fly    25 AMEAVKLGTATVGLKNKDYAVLVA---LCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSR 86

  Fly    61 FISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLAGYDAVEGPDLHY 119
            ::......||  |.|..:...:...|  .|.:.::|.|:      |.|.:|:||||. .||.::.
  Fly    87 YLRSECLNYK--HSYDTTYPVSRLIT--NLGNKMQTTTQRYDRRPYGVGLLVAGYDE-RGPHIYQ 146

  Fly   120 I 120
            :
  Fly   147 V 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 32/131 (24%)
proteasome_beta_type_2 3..194 CDD:239727 31/130 (24%)
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 32/131 (24%)
proteasome_alpha_type_1 6..219 CDD:239718 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.