DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:223 Identity:58/223 - (26%)
Similarity:93/223 - (41%) Gaps:27/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            :|:||...|.|:|.:||...:..:....:.||||.|.|.......|...||...|...|..|.|:
  Fly    50 SIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLH 114

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ----VAMLLAGYDAVEGPDLHYIDSYGAAQSIN 130
            :::....:....|:...|:||       .|||    .|:::.|.|.. ||.|:.|...|:...|.
  Fly   115 RLNTERRVPVVCASMMLRRTL-------FRYQGHIGAALVMGGVDTT-GPQLYCIYPCGSNDKIP 171

  Fly   131 HAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKG------ 189
            :|..|.|::...|:|:..|...|..|....|:::.:.......:.:..|.::.|:.:||      
  Fly   172 YAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGAVYLRT 236

  Fly   190 ----MRKME-----AINPGSLNKESISL 208
                ..|.|     .|.|.|....|||:
  Fly   237 DTIASEKGERLGKYGIKPNSTMVTSISV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 51/202 (25%)
proteasome_beta_type_2 3..194 CDD:239727 51/202 (25%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 50/198 (25%)
proteasome_beta_type_7 49..236 CDD:239732 50/193 (26%)
Pr_beta_C 241..274 CDD:289249 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441136
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.