Sequence 1: | NP_001259950.1 | Gene: | Prosbeta4R2 / 33451 | FlyBaseID: | FBgn0031443 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571226.1 | Gene: | psmb5 / 30387 | ZFINID: | ZDB-GENE-990415-215 | Length: | 269 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 38/196 - (19%) |
---|---|---|---|
Similarity: | 80/196 - (40%) | Gaps: | 17/196 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
Fly 70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ-------VAMLLAGYDAVEGPDLHYIDSYGAAQ 127
Fly 128 SINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRK 192
Fly 193 M 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4R2 | NP_001259950.1 | PRE1 | 1..194 | CDD:223711 | 38/196 (19%) |
proteasome_beta_type_2 | 3..194 | CDD:239727 | 38/196 (19%) | ||
psmb5 | NP_571226.1 | PTZ00488 | 44..268 | CDD:185666 | 38/196 (19%) |
proteasome_beta_type_5 | 66..253 | CDD:239730 | 38/196 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |