DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Psmb5

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:210 Identity:43/210 - (20%)
Similarity:89/210 - (42%) Gaps:17/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            |.|..|....|::|:|:..............|:..::.:.:....|...|...:...:::...:|
  Rat    61 TTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY 125

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ-------VAMLLAGYDAVEGPDLHYIDSYGAAQ 127
            ::.:...:|..:|:    |.||:.:     ||       :..::.|:|. .||.|:|:||.|...
  Rat   126 ELRNKERISVAAAS----KLLANMV-----YQYKGMGLSMGTMICGWDK-RGPGLYYVDSEGNRI 180

  Fly   128 SINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRK 192
            |......|.||::...::.|.::..|..|:||.|.::.:.:...|...:.....:|.|...|..:
  Rat   181 SGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIR 245

  Fly   193 MEAINPGSLNKESIS 207
            :.:.|...|:.:..|
  Rat   246 VSSDNVADLHDKYTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 40/195 (21%)
proteasome_beta_type_2 3..194 CDD:239727 40/195 (21%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 43/210 (20%)
proteasome_beta_type_5 60..247 CDD:239730 40/195 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.