DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Psma4

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:227 Identity:47/227 - (20%)
Similarity:87/227 - (38%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AME------TILGIKGPDFVMLASDTMQAKSL---VFMKDDQSKIHRLSDFNMMATVGDGGDTIQ 57
            |||      |.|||...|.|:||::......|   ||..:   ||::|::....:..|...|...
Mouse    24 AMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSE---KIYKLNEDMACSVAGITSDANV 85

  Fly    58 FTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLAGYDAVEGPD 116
            .|:.:......|.:.:...:..:...    ..|.|..:..|:      :.|::|..|:|...|..
Mouse    86 LTNELRLIAQRYLLQYQEPIPCEQLV----TALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQ 146

  Fly   117 LHYIDSYGAAQSINHAGHGWGSMFCGS--------ILQRYWNSKLSQEDAYSLMKKCVLEIQRRL 173
            |:..|..|     |:.  ||.:...|:        :.|.|...:::.:.|.:|..|         
Mouse   147 LYQSDPSG-----NYG--GWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVK--------- 195

  Fly   174 IINQRNFEVYVVDSKGMRKMEAINPGSLNKES 205
            ::| :..:|..:.:      |.:...:|.:||
Mouse   196 VLN-KTMDVSKLSA------EKVEIATLTRES 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 43/214 (20%)
proteasome_beta_type_2 3..194 CDD:239727 42/213 (20%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 44/221 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.