DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and Psma1

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:214 Identity:45/214 - (21%)
Similarity:72/214 - (33%) Gaps:76/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QSKIHRLSDFNMMATVGDGGDTIQFTDFISKN---------------LHLYKISH---------- 73
            |.:||::.  ..|..|..|..|:...   ||.               .|..||.|          
Mouse    16 QGRIHQIE--YAMEAVKQGSATVGLK---SKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIA 75

  Fly    74 GYHLSAKSAAHFTRK----------------TLADYIRTNTR----------YQVAMLLAGYDAV 112
            |....|:...:|.|:                .|...|.:.|:          |.|.:|:||||.:
Mouse    76 GLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDM 140

  Fly   113 EGPDL-------HYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQ 170
             ||.:       :|.|.  .|.||     |..|....:.|:|:. |:..:.:...|:|..:..::
Mouse   141 -GPHIFQTCPSANYFDC--RAMSI-----GARSQSARTYLERHM-SEFMECNLDELVKHGLRALR 196

  Fly   171 RRLIINQ----RNFEVYVV 185
            ..|...|    :|..:.:|
Mouse   197 ETLPAEQDLTTKNVSIGIV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 45/214 (21%)
proteasome_beta_type_2 3..194 CDD:239727 45/214 (21%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 45/214 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.