Sequence 1: | NP_001259950.1 | Gene: | Prosbeta4R2 / 33451 | FlyBaseID: | FBgn0031443 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506571.1 | Gene: | pas-1 / 179941 | WormBaseID: | WBGene00003922 | Length: | 246 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 24/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH-- 67
Fly 68 --LYKISHGYHLSAKSAAHFTRKTLAD---YIRTNTRYQ---VAMLLAGYDAVEGPDLHYIDSYG 124
Fly 125 AAQSINHAGHGWGSMFCGSILQR--YWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVV-- 185
Fly 186 DSKGMRKM 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4R2 | NP_001259950.1 | PRE1 | 1..194 | CDD:223711 | 44/203 (22%) |
proteasome_beta_type_2 | 3..194 | CDD:239727 | 44/203 (22%) | ||
pas-1 | NP_506571.1 | PRE1 | 7..245 | CDD:223711 | 44/203 (22%) |
proteasome_alpha_type_6 | 8..220 | CDD:239723 | 40/191 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |